Hug Stock Footage: Royalty-Free Video Clips

Royalty-free Stock Footage Clips

Footage

9,721 results found for hug

lovehug friendshandshakefamilyfriendshappycouple hugsadsmilefamily hug
Clear Filters

Media Type

Resolution

Frame Rate

Duration

0:001:00+

Media Details

Usage Rights

Categories

"hug"
Footage

Rear view of adult daughter hugging happy senior mother indoors at home.

Medium Shot - Two people hug each other - Slow Motion - shot on RED

Embracing Love: Real Emotions, Positive Atmosphere

Candid Loving Older Couple Hugging. Senior Husband Embracing Wife in front of window

Couple is hugging. Hands of man and woman. Give more hugs.

Close-up of woman giving a warm hug to a man outdoors

Young people celebrate birthday with dance and hugs. Emotional moment of togetherness.

Manly hug of hands in forest, steadycam shot, slow motion shot at 60fps

Medium Shot - Two men greet and hug each other at a park - shot on RED

Portrait of couple hands, sitting on sofa at home in the living room.

Father lifting child in air over scenic sunset sky. Daddy and daughter playing together, side view, slow motion.

A Joyful Evening on the Beach: Couple Embracing

Newlywed couple posing in a chic indoor setting. Camera captures their elegance.

Couple embracing after conflict, showing support and forgiveness in living room

Happy couple hugging in the city, slow motion, shot at 60fps

Loving couple sharing affectionate moment while strolling together

Senior couple hugging in the city during sunset, 120fps

Loving couple embracing outdoors

Mother and daughter enjoying a peaceful beach together

Sunset Silhouette of Couple Embracing at Beach

Group of Young People Embrace

Couple embracing at home

Family Fun at Sunset: Parents and Child Enjoying Time Together in the Park

Overjoyed ecstatic friendly professional multiracial team business people group bonding celebrating triumph good teamwork result success together standing in office, rewards and achievements concept

Emotional girlfriend hugs boyfriend intimately. - Slow Motion - shot on RED

Girl hugging a guy, close-up of hands interlocking on the back of a boyfriend

Cool Couple Laughing and hugging In Front Of Beach In autumn

Loving couple sharing affectionate moment while strolling together

Black man working from home hugging his 3 year old daughter while sitting together on sofa in cozy bit messy living room

Loving Asian mother and daughter enjoy picnic and storytime in the park. Parenting and family bonding during summer vacation.

Two joyful friends embracing in a park. Diverse women in vibrant outfits enjoy a laughter-filled gathering.

Man and woman hugging. Couple standing indoors. Interesting facts about hugs.

Two Happy Girlfriends

Man Twists Partner in His Arms. Close-up.

Portrait Of Two Sisters Sitting On Sofa At Home Smiling Into Camera

Father hugs his son on the field at sunset. Slowmo

Three friends embracing each other. Heartwarming bond. Meeting in slow motion.

Active retired old men and leisure, two senior black brothers talking and hugging in park. Sequence

Medium shot of affectionate elderly Caucasian woman hugging son or grandson and talking to him

Close up of happy senior woman getting gift from friend during celebration outdoors on patio

NEW

Young boy lovingly hugging baby sibling in mother’s arms during a tender family moment on the couch, displaying strong sibling bond and affection, monochrome video.

The couple standing against a starry sky with a northern light. time lapse

Two happy women hug each other when meeting after long separation

Concept of love and friendship. Woman and her border collie dog holding hands and looking at each other. Touching moment of sincerity. Dogs are best friends. Relationship between human and animal.

Reunion of diverse friends in apartment, smiling and talking

Family enjoying autumn walk in the park. Slow motion.

The man and woman standing near vehicle against the sunset. time lapse

A Couple Embraces in a Stunning Sunset